TPR anticorps

N° du produit ABIN7881865

L’anticorps anti-TPR Polyclonal Lapin est utilisé pour la détection de TPR dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IHC (p), IF et FACS.

Aperçu rapide pour TPR anticorps (ABIN7881865)

Antigène: TPR (Nucleoprotein TPR (TPR))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Détail du produit anti-TPR anticorps

Fonction: TPR Antibody / Translocated promoter region protein

Séquence: AAVLQQVLER TELNKLPKSV QNKLEKFLAD QQ

Purification: Antigen affinity purified

Immunogène: Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TPR antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the TPR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur TPR

Antigène: TPR (Nucleoprotein TPR (TPR))

Autre désignation: TPR

Sujet: The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.

UniProt: P12270