RHOB anticorps

N° du produit ABIN7882139

Cet anticorps anti-RHOB Polyclonal Lapin (ABIN7882139) détecte spécifiquement RHOB dans WB, IF et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris, Rat et Singe.

Aperçu rapide pour RHOB anticorps (ABIN7882139)

Antigène: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Reactivité: Humain, Souris, Rat, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOB est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-RHOB anticorps

Fonction: RHOB Antibody

Séquence: NKKDLRSDEH VRTELARMKQ EPVRTDDGRA MAVRIQAYDY LE

Purification: Antigen affinity purified

Immunogène: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the RHOB antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur RHOB

Antigène: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Autre désignation: RHOB

Sujet: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.

UniProt: P62745