SLC34A2 anticorps

N° du produit ABIN7882316

Cet anticorps anti-SLC34A2 Polyclonal Lapin (ABIN7882316) détecte spécifiquement SLC34A2 dans WB, IF et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour SLC34A2 anticorps (ABIN7882316)

Antigène: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC34A2 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-SLC34A2 anticorps

Fonction: SLC34A2 Antibody

Séquence: QNWTMKNVTY KENIAKCQHI FVNFHLPDLA

Purification: Antigen affinity purified

Immunogène: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SLC34A2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SLC34A2

Antigène: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Autre désignation: SLC34A2

Sujet: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

UniProt: O95436