SYNPO anticorps

N° du produit ABIN7882410

Cet anticorps Lapin Polyclonal détecte spécifiquement SYNPO dans WB, IF, IHC (p) et FACS. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour SYNPO anticorps (ABIN7882410)

Antigène: SYNPO (Synaptopodin (SYNPO))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYNPO est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-SYNPO anticorps

Fonction: SYNPO Antibody / Synaptopodin

Séquence: EKPKVTPNPD LLDLVQTADE KRRQRDHGEV GMEEE

Purification: Affinity purified

Immunogène: Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein were used as the immunogen for the SYNPO antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SYNPO antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SYNPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SYNPO

Antigène: SYNPO (Synaptopodin (SYNPO))

Autre désignation: SYNPO

Sujet: The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.

UniProt: Q8N3V7