ZEB1 anticorps

N° du produit ABIN7882723

L’anticorps anti-ZEB1 Monoclonal Souris est utilisé pour la détection de ZEB1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB et IHC (p).

Aperçu rapide pour ZEB1 anticorps (ABIN7882723)

Antigène: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ZEB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 8B12D1

Détail du produit anti-ZEB1 anticorps

Fonction: TCF-8 Antibody / ZEB1 / AREB6

Séquence: LLKAYYALNA QPSAEELSKI ADSVNLPLDV VKKWFEKMQ

Purification: Antigen affinity purified

Immunogène: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the TCF-8 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the TCF-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ZEB1

Antigène: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Autre désignation: TCF-8

Sujet: ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.

UniProt: P37275

Pathways: Regulation of Muscle Cell Differentiation