ZEB1 anticorps

N° du produit ABIN7882724

Cet anticorps anti-ZEB1 Polyclonal Lapin (ABIN7882724) détecte spécifiquement ZEB1 dans WB, IF, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ZEB1 anticorps (ABIN7882724)

Antigène: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZEB1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ZEB1 anticorps

Fonction: ZEB1 Antibody

Séquence: LLKAYYALNA QPSAEELSKI ADSVNLPLDV VKKWFEKMQ

Purification: Affinity purified

Immunogène: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the ZEB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ZEB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ZEB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ZEB1

Antigène: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Autre désignation: ZEB1

Sujet: Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

UniProt: P37275

Pathways: Regulation of Muscle Cell Differentiation