Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Aquaporin 4 anticorps (C-Term, Intracellular)

Cet anticorps anti-Aquaporin 4 Polyclonal Lapin (ABIN7884767) détecte spécifiquement Aquaporin 4 dans WB, IHC, IF, FACS et IC. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.
N° du produit ABIN7884767
1.466,46 €
Plus frais de livraison 40,00 € et TVA
200 μL
Destination: France
Envoi sous 8 à 9 jours ouvrables

Aperçu rapide pour Aquaporin 4 anticorps (C-Term, Intracellular) (ABIN7884767)

Antigène

Voir toutes Aquaporin 4 (AQP4) Anticorps
Aquaporin 4 (AQP4)

Reactivité

  • 106
  • 80
  • 68
  • 4
  • 4
  • 1
  • 1
  • 1
  • 1
Humain, Souris, Rat

Hôte

  • 97
  • 39
  • 1
  • 1
Lapin

Clonalité

  • 85
  • 52
  • 1
Polyclonal

Conjugué

  • 77
  • 15
  • 5
  • 4
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp Aquaporin 4 est non-conjugé

Application

  • 90
  • 75
  • 31
  • 28
  • 25
  • 24
  • 20
  • 16
  • 13
  • 13
  • 5
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Immunochromatography (IC)

Classe de qualité

Carrier-free, KO Validated
  • Épitope

    • 25
    • 16
    • 16
    • 7
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 249-323, C-Term, Intracellular

    Fonction

    A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

    Homologie

    Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64

    Purification

    The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

    Immunogène

    GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4

    Isotype

    IgG
  • Indications d'application

    WB: 1:1000

    FC: The optimal concentration should be determined by the user

    ICC: The optimal concentration should be determined by the user

    IHC: The optimal concentration should be determined by the user

    IP: The optimal concentration should be determined by the user

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Reconstitution

    0.2 mL double distilled water (DDW)

    Concentration

    1 mg/mL

    Buffer

    PBS pH 7.4

    Agent conservateur

    Without preservative

    Stock

    -20 °C

    Stockage commentaire

    The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
  • Antigène

    Aquaporin 4 (AQP4)

    Autre désignation

    WCH4

    Sujet

    Synonyms: WCH4, Mercurial-insensitive water channel

    Description: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

    ID gène

    25293

    UniProt

    P47863

    Pathways

    Sensory Perception of Sound
Vous êtes ici:
Chat with us!