STX1A anticorps (Intracellular, N-Term)

N° du produit ABIN7885557

Cet anticorps Lapin Polyclonal détecte spécifiquement STX1A dans WB, IHC et IF. Il présente une réactivité avec des échantillons de Souris et Rat.

Aperçu rapide pour STX1A anticorps (Intracellular, N-Term) (ABIN7885557)

Antigène: STX1A (Syntaxin 1A (Brain) (STX1A))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STX1A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)

Classe de qualité: Carrier-free

Détail du produit anti-STX1A anticorps

Épitope: AA 1-265, Intracellular, N-Term

Fonction: A Rabbit Polyclonal Antibody to Syntaxin 1

Homologie: Human,mouse- 264,265 amino acid residues identical

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène: GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A

Isotype: IgG

Information d'application

Indications d'application:

WB: 1:1000

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Commentaires:

Negative Control: (ABIN7237335)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW)

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Agent conservateur: Without preservative

Stock: -20 °C

Stockage commentaire: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Détails sur STX1A

Antigène: STX1A (Syntaxin 1A (Brain) (STX1A))

Autre désignation: STX1A

Sujet:

Synonyms: STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Description: Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60-70 amino acids that are arranged in heptad repeats1,2.SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1,2.SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1,2.Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1,2.Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

ID gène: 116470

UniProt: P32851

Pathways: Peptide Hormone Metabolism, Synaptic Membrane, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport