AICDA anticorps (N-Term)

N° du produit ABIN8093920

Cet anticorps Lapin Polyclonal détecte spécifiquement AICDA dans IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Lapin, Chien, Boeuf (Vache), Porc, Cobaye et Cheval.

Aperçu rapide pour AICDA anticorps (N-Term) (ABIN8093920)

Antigène: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Reactivité: Humain, Souris, Rat, Lapin, Chien, Boeuf (Vache), Porc, Cobaye, Cheval

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AICDA est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-AICDA anticorps

Épitope: N-Term

Fonction: AICDA Antibody N-terminal region

Séquence: VKRRDSATSF SLDFGYLRNK NGCHVELLFL RYISDWDLDP GRCYRVTWFT

Homologie: Cow: 93%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 100%, Rabbit: 100%, Rat: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63254-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur AICDA

Antigène: AICDA (Activation-Induced Cytidine Deaminase (AICDA))

Autre désignation: AICDA

Sujet:

Background Information: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).

Gene Name: activation-induced cytidine deaminase

Alternative Symbols: AID, ARP2, CDA2, HIGM2, HEL-S-284

Protein Name: Activation-induced cytidine deaminase

Poids moléculaire: 24 kDa

ID gène: 57379

NCBI Accession: NP_065712

UniProt: Q9GZX7

Pathways: Cellular Response to Molecule of Bacterial Origin, Regulation of Actin Filament Polymerization, Production of Molecular Mediator of Immune Response