Adrenomedullin 2 anticorps

N° du produit ABIN8094281

L’anticorps anti-Adrenomedullin 2 Polyclonal Lapin est utilisé pour la détection de Adrenomedullin 2 dans des échantillons de Humain, Rat, Souris, Boeuf (Vache), Cheval et Porc. Il a été validé pour IHC.

Aperçu rapide pour Adrenomedullin 2 anticorps (ABIN8094281)

Antigène: Adrenomedullin 2 (ADM2)

Reactivité: Humain, Rat, Souris, Boeuf (Vache), Cheval, Porc

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adrenomedullin 2 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-Adrenomedullin 2 anticorps

Fonction: ADM2 Antibody

Séquence: GPRRTQAQLL RVGCVLGTCQ VQNLSHRLWQ LMGPAGRQDS APVDPSSPHS

Homologie: Cow: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 83%, Rat: 93%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64721-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur Adrenomedullin 2

Antigène: Adrenomedullin 2 (ADM2)

Autre désignation: ADM2

Sujet:

Background Information: This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Gene Name: adrenomedullin 2

Alternative Symbols: AM2, dJ579N16.4

Protein Name: ADM2

Poids moléculaire: 16 kDa

ID gène: 79924

NCBI Accession: NP_079142

UniProt: Q7Z4H4

Pathways: Hormone Activity, Feeding Behaviour