DUOXA2 anticorps

N° du produit ABIN8099231

L’anticorps anti-DUOXA2 Polyclonal Lapin est utilisé pour la détection de DUOXA2 dans des échantillons de Humain, Boeuf (Vache), Chien, Cobaye, Cheval, Souris, Lapin et Rat. Il a été validé pour IHC.

Aperçu rapide pour DUOXA2 anticorps (ABIN8099231)

Antigène: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Reactivité: Humain, Boeuf (Vache), Chien, Cobaye, Cheval, Souris, Lapin, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DUOXA2 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-DUOXA2 anticorps

Fonction: DUOXA2 Antibody

Séquence: RWFWLVRVLL SLFIGAEIVA VHFSAEWFVG TVNTNTSYKA FSAARVTARV

Homologie: Cow: 86%, Dog: 86%, Guinea Pig: 86%, Horse: 86%, Human: 100%, Mouse: 86%, Rabbit: 86%, Rat: 86%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64802-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur DUOXA2

Antigène: DUOXA2 (Dual Oxidase Maturation Factor 2 (DUOXA2))

Autre désignation: DUOXA2

Sujet:

Background Information: This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5.

Gene Name: dual oxidase maturation factor 2

Alternative Symbols: TDH5, SIMNIPHOM

Protein Name: Dual oxidase maturation factor 2

Poids moléculaire: 35 kDa

ID gène: 405753

NCBI Accession: NP_997464

UniProt: Q1HG44

Pathways: Thyroid Hormone Synthesis