GALP anticorps

N° du produit ABIN8101248

Cet anticorps anti-GALP Polyclonal Lapin (ABIN8101248) détecte spécifiquement GALP dans IHC. L’anticorps est réactif avec des échantillons de Humain et Porc.

Aperçu rapide pour GALP anticorps (ABIN8101248)

Antigène: GALP (Galanin-Like Peptide (GALP))

Reactivité: Humain, Porc

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALP est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-GALP anticorps

Fonction: GALP Antibody

Séquence: VLHLPQMGDQ DGKRETALEI LDLWKAIDGL PYSHPPQPSK RNVMETFAKP

Homologie: Human: 100%, Pig: 93%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63212-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur GALP

Antigène: GALP (Galanin-Like Peptide (GALP))

Autre désignation: GALP

Sujet:

Background Information: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors.

Gene Name: galanin-like peptide

Protein Name: Galanin-like peptide

Poids moléculaire: 13 kDa

ID gène: 85569

NCBI Accession: NP_149097

UniProt: Q9UBC7