GCSH anticorps

N° du produit ABIN8101739

L’anticorps anti-GCSH Polyclonal Lapin est utilisé pour la détection de GCSH dans des échantillons de Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin et Cobaye. Il a été validé pour IHC.

Aperçu rapide pour GCSH anticorps (ABIN8101739)

Antigène: GCSH (Glycine Cleavage System H Protein (GCSH))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCSH est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-GCSH anticorps

Fonction: GCSH Antibody

Séquence: IGTVGISNFA QEALGDVVYC SLPEVGTKLN KQDEFGALES VKAASELYSP

Homologie: Cow: 93%, Dog: 100%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 86%, Rabbit: 93%, Rat: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64204-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur GCSH

Antigène: GCSH (Glycine Cleavage System H Protein (GCSH))

Autre désignation: GCSH

Sujet:

Background Information: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.

Gene Name: glycine cleavage system protein H (aminomethyl carrier)

Alternative Symbols: GCE, NKH

Protein Name: Glycine cleavage system H protein, mitochondrial

Poids moléculaire: 19 kDa

ID gène: 2653

NCBI Accession: NP_004474

UniProt: P23434