MSRB3 anticorps

N° du produit ABIN8105257

Cet anticorps Lapin Polyclonal détecte spécifiquement MSRB3 dans IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Saccharomyces cerevisiae et Poisson zèbre (Danio rerio).

Aperçu rapide pour MSRB3 anticorps (ABIN8105257)

Antigène: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Saccharomyces cerevisiae, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSRB3 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-MSRB3 anticorps

Fonction: MSRB3 Antibody

Séquence: ESAFEGEYTH HKDPGIYKCV VCGTPLFKSE TKFDSGSGWP SFHDVINSEA

Homologie: Cow: 100%, Dog: 86%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 79%, Zebrafish: 86%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61892-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur MSRB3

Antigène: MSRB3 (Methionine Sulfoxide Reductase B3 (MSRB3))

Autre désignation: MSRB3

Sujet:

Background Information: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.

Gene Name: methionine sulfoxide reductase B3

Alternative Symbols: DFNB74

Protein Name: Methionine-R-sulfoxide reductase B3

Poids moléculaire: 21 kDa

ID gène: 253827

NCBI Accession: NP_932346

UniProt: Q8IXL7