PLAC8 anticorps

N° du produit ABIN8108297

L’anticorps anti-PLAC8 Polyclonal Lapin est utilisé pour la détection de PLAC8 dans des échantillons de Humain et Boeuf (Vache). Il a été validé pour IHC.

Aperçu rapide pour PLAC8 anticorps (ABIN8108297)

Antigène: PLAC8 (Placenta-Specific 8 (PLAC8))

Reactivité: Humain, Boeuf (Vache)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLAC8 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-PLAC8 anticorps

Fonction: PLAC8 Antibody

Séquence: AQAPVVVVTQ PGVGPGPAPQ NSNWQTGMCD CFSDCGVCLC GTFCFPCLGC

Homologie: Cow: 93%, Human: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47959-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur PLAC8

Antigène: PLAC8 (Placenta-Specific 8 (PLAC8))

Autre désignation: PLAC8

Sujet:

Gene Name: placenta-specific 8

Alternative Symbols: C15, DGIC, onzin, PNAS-144

Protein Name: Placenta-specific gene 8 protein

Poids moléculaire: 13 kDa

ID gène: 51316

NCBI Accession: NP_057703

UniProt: Q9NZF1

Pathways: Brown Fat Cell Differentiation