RHCG anticorps

N° du produit ABIN8110461

Cet anticorps anti-RHCG Polyclonal Lapin (ABIN8110461) détecte spécifiquement RHCG dans IHC. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Mouton et Poisson zèbre (Danio rerio).

Aperçu rapide pour RHCG anticorps (ABIN8110461)

Antigène: RHCG (Rh Family C Glycoprotein (RHCG))

Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Mouton, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHCG est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-RHCG anticorps

Fonction: RHCG Antibody

Séquence: QSKERQNSVY QSDLFAMIGT LFLWMYWPSF NSAISYHGDS QHRAAINTYC

Homologie: Cow: 86%, Dog: 79%, Guinea Pig: 86%, Horse: 79%, Human: 100%, Mouse: 79%, Rat: 86%, Sheep: 86%, Zebrafish: 86%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP42465-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur RHCG

Antigène: RHCG (Rh Family C Glycoprotein (RHCG))

Autre désignation: RHCG

Sujet:

Gene Name: Rh family, C glycoprotein

Alternative Symbols: RHGK, PDRC2, C15orf6, SLC42A3

Protein Name: Ammonium transporter Rh type C

Poids moléculaire: 53 kDa

ID gène: 51458

NCBI Accession: NP_057405

UniProt: Q9UBD6