RHCG anticorps (C-Term)

N° du produit ABIN8110462

Cet anticorps Lapin Polyclonal détecte spécifiquement RHCG dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RHCG anticorps (C-Term) (ABIN8110462)

Antigène: RHCG (Rh Family C Glycoprotein (RHCG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHCG est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RHCG anticorps

Épitope: C-Term

Fonction: RHCG Antibody - C-terminal region

Séquence: NCFEDAVYWE MPEGNSTVYI PEDPTFKPSG PSVPSVPMVS PLPMASSVPL

Homologie: Human: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP42466-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur RHCG

Antigène: RHCG (Rh Family C Glycoprotein (RHCG))

Autre désignation: RHCG

Sujet:

Gene Name: Rh family, C glycoprotein

Alternative Symbols: RHGK, PDRC2, C15orf6, SLC42A3

Protein Name: Ammonium transporter Rh type C

Poids moléculaire: 53 kDa

ID gène: 51458

NCBI Accession: NP_057405

UniProt: Q9UBD6