NEU2 anticorps

N° du produit ABIN8111686

Cet anticorps Lapin Polyclonal détecte spécifiquement NEU2 dans IHC. Il présente une réactivité avec des échantillons de Humain, Rat, Souris, Chien, Porc, Boeuf (Vache), Cobaye et Lapin.

Aperçu rapide pour NEU2 anticorps (ABIN8111686)

Antigène: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Reactivité: Humain, Rat, Souris, Chien, Porc, Boeuf (Vache), Cobaye, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEU2 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-NEU2 anticorps

Fonction: NEU2 Antibody

Séquence: SGAHAYRIPA LLYLPGQQSL LAFAEQRASK KDEHAELIVL RRGDYDAPTH

Homologie: Cow: 79%, Dog: 86%, Guinea Pig: 85%, Human: 100%, Mouse: 86%, Pig: 86%, Rabbit: 77%, Rat: 79%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64280-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur NEU2

Antigène: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Autre désignation: NEU2

Sujet:

Background Information: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.

Gene Name: sialidase 2 (cytosolic sialidase)

Alternative Symbols: SIAL2

Protein Name: Sialidase-2

Poids moléculaire: 42 kDa

ID gène: 4759

NCBI Accession: NP_005374

UniProt: Q9Y3R4

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development