STXBP2 anticorps

N° du produit ABIN8113314

Cet anticorps anti-STXBP2 Polyclonal Lapin (ABIN8113314) détecte spécifiquement STXBP2 dans IHC. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Cobaye, Lapin et Poisson zèbre (Danio rerio).

Aperçu rapide pour STXBP2 anticorps (ABIN8113314)

Antigène: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Cobaye, Lapin, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STXBP2 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-STXBP2 anticorps

Fonction: STXBP2 Antibody

Séquence: CMKHFKGSVE KLCSVEQDLA MGSDAEGEKI KDSMKLIVPV LLDAAVPAYD

Homologie: Cow: 100%, Dog: 92%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 92%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64422-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur STXBP2

Antigène: STXBP2 (Syntaxin Binding Protein 2 (STXBP2))

Autre désignation: STXBP2

Sujet:

Background Information: This gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Gene Name: syntaxin binding protein 2

Alternative Symbols: FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

Protein Name: Syntaxin-binding protein 2

Poids moléculaire: 66 kDa

ID gène: 6813

NCBI Accession: NP_008880

UniProt: Q15833

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis