Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

GREM1 Protéine

GREM1 Origine: Humain Hôte: Escherichia coli (E. coli) Recombinant > 95 % by SDS-PAGE. Visualized by silver stain
N° du produit ABIN1589732
  • Antigène Voir toutes GREM1 Protéines
    GREM1 (Gremlin 1 (GREM1))
    Type de proteíne
    Recombinant
    Origine
    • 14
    • 4
    • 4
    • 3
    • 1
    • 1
    Humain
    Source
    • 12
    • 4
    • 4
    • 3
    • 2
    • 2
    Escherichia coli (E. coli)
    Séquence
    MKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQG RGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTI HEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSF CKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL D
    Attributs du produit
    Length (AA): 161
    Chromosomal location: 15q13.3
    Pureté
    > 95 % by SDS-PAGE. Visualized by silver stain
    Top Product
    Discover our top product GREM1 Protéine
  • Indications d'application
    No biological data available at the moment.
    Commentaires

    Cytokines & Growth Factors

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Human Grem1 should be reconstituted in 50 mM acetic acid or sterile water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 °C.
    Buffer
    50 mM acetic acid
    Conseil sur la manipulation
    Avoid repeated freeze-thaw cycles.
    Stock
    0 °C
    Stockage commentaire
    The lyophilized human Grem1, though stable at room temperature, is best stored desiccated below 0 °C.
  • Antigène
    GREM1 (Gremlin 1 (GREM1))
    Autre désignation
    Gremlin-1 (GREM1 Produits)
    Synonymes
    grem1 Protein, MGC136702 Protein, zgc:136702 Protein, GREM1 Protein, drm Protein, pig2 Protein, dand2 Protein, ihg-2 Protein, gremlin Protein, Cktsf1b1 Protein, Drm Protein, Grem Protein, ld Protein, gremlin-1 Protein, CKTSF1B1 Protein, DAND2 Protein, DRM Protein, GREMLIN Protein, IHG-2 Protein, cktsf1b1 Protein, gremlin 1a, DAN family BMP antagonist Protein, gremlin 1, DAN family BMP antagonist Protein, gremlin 1 Protein, gremlin 1, DAN family BMP antagonist L homeolog Protein, grem1a Protein, GREM1 Protein, LOC662541 Protein, grem1 Protein, Grem1 Protein, grem1.L Protein
    Sujet
    Gremlin, also known as “Increased in High Glucose protein 2” (IHG2) and “Down regulated in Mos-transformed cells protein” (Drm), is a 28 kDa member of the Dan family of secreted glycoproteins. Native human Gremlin consist of 160 amino acids. The mature region contains one potential site for N-linked glycosylation (Asn42), a cysteine-rich region, and a cysteine-knot motif (aa94-184) whose structure is shared by members of the TGFβ superfamily. Posttranslational modifications include glycosylation and phosphorylation (1-3). Human Gremlin exists in both secreted and membrane-associated forms and there exist 2 isoforms. The aa sequence identity of human Gremlin with mouse and chicken Gremlin is 99% and 86 %, respectively. Northern blot analysis shows that Gremlin mRNA is highly expressed in the small intestine, fetal brain and colon, and weakly expressed in adult brain, ovary, prostate, pancreas and skeletal muscle. Gremlin functions as a bone morphogenetic protein (BMP) antagonist. It acts by binding to, and forming heterodimers with, BMP2, BMP4, and BMP7, thus preventing them from interacting with their cell surface receptors. This mechanism is thought to be responsible for the pattern-inducing activity of Gremlin during embryonic development and to play a role in human diseases, such as diabetic nephropathy). However, intracellular BMP-independent mechanisms of action may mediate the ability of Gremlin to suppress transformation and tumor genesis under certain experimental conditions. Gremlin also interacts with Slit proteins and acts as an inhibitor of monocyte chemotaxis. In addition, Gremlin has been found to be a proangiogenic factor expressed by endothelium. Furthermore Gremlin is a novel agonist of the major proangiogenic receptor VEGFR2.
    Synonyms: GREM1, DRM, PIG2, DAND2, IHG-2, GREMLIN, CKTSF1B1, Cell proliferation-inducing gene 2 protein, Cysteine knot superfamily 1, BMP antagonist 1, DAN domain family member 2, Down-regulated in Mos-transformed cells protein, Increased in high glucose protein 2
    Poids moléculaire
    18.4 kDa
    NCBI Accession
    NP_037504, NM_013372
    UniProt
    O60565
    Pathways
    Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location
Vous êtes ici:
Support technique