SCN3B anticorps (N-Term)
Aperçu rapide pour SCN3B anticorps (N-Term) (ABIN633798)
Antigène
Voir toutes SCN3B AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- N-Term
-
Specificité
- SCN3 B antibody was raised against the N terminal of SCN3
-
Purification
- Affinity purified
-
Immunogène
- SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
-
-
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (Biotin)
SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 Biotin
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (APC)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 APC
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (HRP)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 HRP
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (FITC)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 FITC
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (Atto 594)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 Atto 594
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (Atto 390)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 Atto 390
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (PerCP)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 PerCP
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (PE)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 PE
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibodySCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 unconjugated
anti-Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B) (AA 1-215) antibody (Atto 488)SCN3B Reactivité: Rat WB, ICC, IF Hôte: Souris Monoclonal S396-29 Atto 488
-
-
Indications d'application
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
SCN3B Blocking Peptide, (ABIN5616014), is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))
-
Autre désignation
- SCN3B
-
Sujet
- SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
-
Poids moléculaire
- 24 kDa (MW of target protein)
Antigène
-
