CEACAM6 anticorps
Aperçu rapide pour CEACAM6 anticorps (ABIN629794)
Antigène
Voir toutes CEACAM6 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Purified
-
Immunogène
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
-
-
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibody
CEACAM6 Reactivité: Humain WB, ELISA, FACS, IHC (fro), cELISA Hôte: Souris Monoclonal 9A6 unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibodyCEACAM6 Reactivité: Humain WB, IF Hôte: Lapin Monoclonal unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) (AA 156-265) antibodyCEACAM6 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1G2 unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibodyCEACAM6 Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) (AA 35-142) antibodyCEACAM6 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) (AA 35-320) antibodyCEACAM6 Reactivité: Humain IHC, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) (AA 216-265) antibodyCEACAM6 Reactivité: Humain WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibodyCEACAM6 Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 25GB1595 unconjugated Recombinant Antibody
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibody (PE)CEACAM6 Reactivité: Humain FACS Hôte: Souris Monoclonal B6-2 PE
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6) antibodyCEACAM6 Reactivité: Humain FACS, IP Hôte: Souris Monoclonal B6-2 unconjugated
-
-
Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
CEACAM6 Blocking Peptide, (ABIN937869), is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Autre désignation
- CEACAM6
-
Sujet
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
-
Poids moléculaire
- 38 kDa (MW of target protein)
Antigène
-
