GNA12 anticorps
Aperçu rapide pour GNA12 anticorps (ABIN631704)
Antigène
Voir toutes GNA12 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
-
-
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (AA 112-270) antibody
GNA12 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (Internal Region) antibodyVerified GNA12 Reactivité: Humain, Souris WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (C-Term) antibodyGNA12 Reactivité: Humain, Rat, Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (AA 301-381) antibodyGNA12 Reactivité: Humain ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (Ser67) antibodyGNA12 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (AA 146-195) antibodyGNA12 Reactivité: Humain, Rat, Souris, Chien, Cobaye, Cheval, Lapin, Boeuf (Vache), Poisson zèbre (Danio rerio), Hamster, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (AA 1-200) antibodyGNA12 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (AA 46-75) antibodyGNA12 Reactivité: Humain WB Hôte: Lapin Polyclonal RB10995 unconjugated
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (Middle Region) antibodyGNA12 Reactivité: Humain, Rat, Souris, Chien, Cobaye, Cheval, Lapin, Boeuf (Vache), Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
GNA12 Blocking Peptide, (ABIN5613804), is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA12 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))
-
Autre désignation
- GNA12
-
Sujet
- GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
-
Poids moléculaire
- 44 kDa (MW of target protein)
Antigène
-
