HSPA2 anticorps (Middle Region)
Aperçu rapide pour HSPA2 anticorps (Middle Region) (ABIN634202)
Antigène
Voir toutes HSPA2 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- HSPA2 antibody was raised against the middle region of HSPA2
-
Purification
- Affinity purified
-
Immunogène
- HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK
-
-
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 1-639) antibody
HSPA2 Reactivité: Humain WB, IP, ELISA, IHC (p) Hôte: Souris Monoclonal S51 unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 1-639) antibodyHSPA2 Reactivité: Humain WB, IP, ELISA, IF Hôte: Souris Monoclonal 3H7 unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 1-639) antibodyHSPA2 Reactivité: Humain WB, IP, ELISA Hôte: Souris Monoclonal 2D11 unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 564-598), (C-Term) antibodyHSPA2 Reactivité: Humain, Rat, Souris WB, IHC, ICC, IF, FACS, IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) antibodyHSPA2 Reactivité: Humain WB, IF Hôte: Lapin Monoclonal unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 564-598), (C-Term) antibodyHSPA2 Reactivité: Humain, Rat, Souris WB, IHC, ICC, IF, FACS Hôte: Souris Monoclonal 4A4 unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 1-639) antibodyHSPA2 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 400-639) antibodyHSPA2 Reactivité: Humain WB, IHC, IP, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) (AA 400-639) antibodyHSPA2 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 70kDa Protein 2 (HSPA2) antibodyHSPA2 Reactivité: Humain, Rat, Souris IF Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
HSPA2 Blocking Peptide, (ABIN939566), is also available for use as a blocking control in assays to test for specificity of this HSPA2 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA2 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))
-
Autre désignation
- HSPA2
-
Sujet
- HSPA2 belongs to the heat shock protein 70 family. In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
-
Poids moléculaire
- 70 kDa (MW of target protein)
Antigène
-
