MTHFD1 anticorps
Aperçu rapide pour MTHFD1 anticorps (ABIN630930)
Antigène
Voir toutes MTHFD1 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
-
-
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 1-935) antibody
MTHFD1 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 535-562) antibodyMTHFD1 Reactivité: Humain WB, IF, IHC (p) Hôte: Lapin Polyclonal RB19391 unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 1-935) antibodyMTHFD1 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) antibodyMTHFD1 Reactivité: Humain, Souris, Rat WB, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) antibodyMTHFD1 Reactivité: Humain, Souris, Rat WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (Internal Region) antibodyVerified MTHFD1 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 1-270) antibodyMTHFD1 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 74-123) antibodyMTHFD1 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Porc, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (AA 863-912) antibodyMTHFD1 Reactivité: Humain, Souris, Rat, Lapin, Cheval, Poisson zèbre (Danio rerio), Porc, Chien, Cobaye, Singe, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (N-Term) antibodyMTHFD1 Reactivité: Humain, Souris, Rat, Lapin, Cheval, Poisson zèbre (Danio rerio), Chien, Cobaye, Boeuf (Vache) WB, IHC Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
MTHFD1 Blocking Peptide, (ABIN5614864), is also available for use as a blocking control in assays to test for specificity of this MTHFD1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- MTHFD1 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1))
-
Autre désignation
- MTHFD1
-
Sujet
- MTHFD1 possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.
-
Poids moléculaire
- 101 kDa (MW of target protein)
-
Pathways
- Methionine Biosynthetic Process
Antigène
-
