PCBP2 anticorps
Aperçu rapide pour PCBP2 anticorps (ABIN630038)
Antigène
Voir toutes PCBP2 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Purified
-
Immunogène
- PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE
-
-
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 1-362) antibody
PCBP2 Reactivité: Humain WB, ELISA, IF, IHC (p), RNAi Hôte: Souris Monoclonal 5F12 unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 1-130) antibodyPCBP2 Reactivité: Humain WB, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) antibodyPCBP2 Reactivité: Humain WB, IF, ICC, IP, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 1-362) antibodyPCBP2 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 6B6 unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 1-362) antibodyPCBP2 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 3A1 unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) antibodyKD Validated PCBP2 Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 23GB2110 unconjugated Recombinant Antibody
anti-Poly(rC) Binding Protein 2 (PCBP2) (Middle Region) antibodyPCBP2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 197-276) antibodyPCBP2 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, FACS Hôte: Lapin Polyclonal unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) antibodyPCBP2 Reactivité: Humain, Souris, Poisson zèbre (Danio rerio) WB, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Poly(rC) Binding Protein 2 (PCBP2) (AA 1-363) antibodyPCBP2 Reactivité: Humain WB, ELISA, IF, IHC, IHC (p), RNAi Hôte: Souris Monoclonal 5F12 unconjugated
-
-
Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
PCBP2 Blocking Peptide, (ABIN939849), is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP2 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))
-
Autre désignation
- PCBP2
-
Sujet
- PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
-
Poids moléculaire
- 39 kDa (MW of target protein)
Antigène
-
