SLC7A8 anticorps
Aperçu rapide pour SLC7A8 anticorps (ABIN630365)
Antigène
Voir toutes SLC7A8 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Purified
-
Immunogène
- SLC7 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
-
-
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) antibody
SLC7A8 Reactivité: Humain WB, FACS, IHC, IHC (p), IF, IP Hôte: Souris Monoclonal 5A9 unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (AA 211-226), (Extracellular) antibodySLC7A8 Reactivité: Rat WB, FACS, IHC, LCI Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (AA 476-506) antibodySLC7A8 Reactivité: Humain WB, FACS Hôte: Lapin Polyclonal RB55244 unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (AA 467-535) antibodySLC7A8 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 3F10 unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (Middle Region) antibodySLC7A8 Reactivité: Humain, Rat, Souris, Boeuf (Vache), Cheval, Poisson zèbre (Danio rerio), Chien, Lapin, Cobaye WB Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) antibodySLC7A8 Reactivité: Humain WB, FACS, IHC, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) antibodySLC7A8 Reactivité: Humain, Souris, Singe WB, FACS, IHC, IHC (p), IF Hôte: Souris Monoclonal 4A6 unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (AA 63-112) antibodySLC7A8 Reactivité: Humain, Rat, Souris, Boeuf (Vache), Cheval, Poisson zèbre (Danio rerio), Lapin, Cobaye, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) (AA 211-226), (Extracellular) antibody (FITC)SLC7A8 Reactivité: Rat FACS, LCI Hôte: Lapin Polyclonal FITC
-
-
Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
SLC7A8 Blocking Peptide, (ABIN5616279), is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))
-
Autre désignation
- SLC7A8
-
Sujet
- SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
-
Poids moléculaire
- 37 kDa (MW of target protein)
Antigène
-
