STAU1/Staufen anticorps
Aperçu rapide pour STAU1/Staufen anticorps (ABIN633486)
Antigène
Voir toutes STAU1/Staufen (STAU1) AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
-
-
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) antibody
KD Validated STAU1 Reactivité: Humain WB, IF (p), FACS Hôte: Lapin Monoclonal 24GB5095 unconjugated Recombinant Antibody
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) antibodySTAU1 Reactivité: Humain, Rat, Souris WB, IF (cc), IF (p), IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (AA 401-496) antibodySTAU1 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1E7 unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (AA 1-577) antibodySTAU1 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (AA 163-403) antibodySTAU1 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (C-Term) antibodySTAU1 Reactivité: Humain, Souris WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (AA 1-577) antibodySTAU1 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (N-Term) antibodySTAU1 Reactivité: Humain, Cheval, Boeuf (Vache), Cobaye, Lapin, Porc, Roussette (Chauve-souris), Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (AA 131-180) antibodySTAU1 Reactivité: Humain, Rat, Cheval, Boeuf (Vache), Lapin, Roussette (Chauve-souris), Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Staufen Double-Stranded RNA Binding Protein 1 (STAU1) (Internal Region) antibodySTAU1 Reactivité: Humain, Rat, Souris WB, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
STAU1 Blocking Peptide, (ABIN5616432), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
-
Autre désignation
- STAU1
-
Sujet
- This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.
-
Poids moléculaire
- 63 kDa (MW of target protein)
-
Pathways
- Asymmetric Protein Localization
Antigène
-
