KIAA1191 anticorps (Middle Region)
-
- Antigène Voir toutes KIAA1191 Anticorps
- KIAA1191
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIAA1191 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA1191 antibody was raised against the middle region of KIAA1191
- Purification
- Affinity purified
- Immunogène
- KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF
- Top Product
- Discover our top product KIAA1191 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA1191 Blocking Peptide, catalog no. 33R-9155, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1191 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIAA1191
- Autre désignation
- KIAA1191 (KIAA1191 Produits)
- Synonymes
- anticorps p60MONOX, anticorps 4930558H15Rik, anticorps C81457, anticorps Kiaa1191, anticorps P33monox, anticorps P33MONOX, anticorps p33monox, anticorps DKFZp469A246, anticorps KIAA1191, anticorps RIKEN cDNA 4833439L19 gene, anticorps KIAA1191 L homeolog, anticorps KIAA1191 ortholog, anticorps KIAA1191, anticorps 4833439L19Rik, anticorps kiaa1191.L, anticorps kiaa1191, anticorps Kiaa1191
- Sujet
- The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 33 kDa (MW of target protein)
-