BNP anticorps (AA 1-32)

N° du produit ABIN108783

Cet anticorps anti-BNP Monoclonal Souris (Clone 17-16) (ABIN108783) détecte spécifiquement BNP dans ELISA. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour BNP anticorps (AA 1-32) (ABIN108783)

Antigène: BNP (Brain Natriuretic Peptide (BNP))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp BNP est non-conjugé

Application: ELISA

Clone: 17-16

Détail du produit anti-BNP anticorps

Épitope: AA 1-32

Specificité: Synthetic human BNP (aa 1-32) Human proBNP (aa 1-108), recombinant

Immunogène: Synthetic human BNP (aa 1-32) KLH conjugated (spkmvqgsgcfgrkmdrissssglgckvlrrh)

Isotype: IgG1

Information d'application

Indications d'application: ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur BNP

Antigène: BNP (Brain Natriuretic Peptide (BNP))

Autre désignation: Brain Natriuretic Peptide

Sujet: Cell culture supernatant protein G purified in PBS pH 74

Pathways: Hormone Activity