PTH anticorps (AA 1-34)

N° du produit ABIN109748

Cet anticorps Lapin Polyclonal détecte spécifiquement PTH dans RIA. Il présente une réactivité envers Humain.

Aperçu rapide pour PTH anticorps (AA 1-34) (ABIN109748)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: Radioimmunoassay (RIA)

Détail du produit anti-PTH anticorps

Épitope: AA 1-34

Specificité: Human PTH (aa 1-34)

Purification: Purified

Immunogène: Synthetic human PTH (aa 1-34), bTG- conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnf)

Information d'application

Indications d'application: RIA (1/10,000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone

Classe de substances: Hormone

Sujet: Serum

ID gène: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process