PTH anticorps (AA 1-38)

N° du produit ABIN110062

Cet anticorps anti-PTH Monoclonal Souris (Clone A1-70) (ABIN110062) détecte spécifiquement PTH dans ELISA, RIA et IHC (fro). L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PTH anticorps (AA 1-38) (ABIN110062)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: A1-70

Détail du produit anti-PTH anticorps

Épitope: AA 1-38

Specificité: Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86)

Purification: Purified

Immunogène: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Information d'application

Indications d'application: RIA (20 ng/ml) Immunohistochemistry (cryo-sections and paraffin sections 2 microg/ml) ELISA (1microg/ml)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone

Classe de substances: Hormone

Sujet: Cell supernatant, Prot. A purified 0,01 M sodiumphosphate, 0,15 M sodium chloride pH 7,2

ID gène: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process