PTH anticorps (AA 1-38)

N° du produit ABIN110064

L’anticorps anti-PTH Monoclonal Souris est utilisé pour la détection de PTH dans des échantillons de Humain. Il a été validé pour ELISA, RIA et IHC (fro).

Aperçu rapide pour PTH anticorps (AA 1-38) (ABIN110064)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: B1-70

Détail du produit anti-PTH anticorps

Épitope: AA 1-38

Specificité: Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84;), PTHrP (aa 1-86).

Purification: Purified

Immunogène: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Information d'application

Indications d'application: RIA (25 ng/ml); Immunohistochemistry (cryo-sections and paraffinsections; 2 μg/ml); ELISA (1 μg/ml)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone

Classe de substances: Hormone

Sujet: Cell culture supernatant, affinity purified, 50 mM TRIS pH 7,4 NaN3 0.05%

ID gène: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process