IL-21 anticorps (AA 40-68)

N° du produit ABIN1819420

Détail du produit anti-IL-21 anticorps

Antigène: IL-21 (IL21) (Interleukin 21 (IL21))

Épitope: AA 40-68

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-21 est non-conjugé

Application: ELISA

Specificité: Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.

Purification: Affinity purified

Immunogène: Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%), Gibbon, Monkey, Marmoset (97%), Sheep, Bovine, Horse (93%), Elephant, Dog (90%), Panda, Cat, Pig (83%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Information d'application

Indications d'application: Approved: ELISA (1:100000)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur IL-21

Antigène: IL-21 (IL21) (Interleukin 21 (IL21))

Autre désignation: IL21 (IL21 Produits)

Synonymes: anticorps IL-21, anticorps Za11, anticorps interleukin 21, anticorps IL21, anticorps Il21

Sujet: Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21

ID gène: 59067

UniProt: Q9HBE4

Pathways: Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response