Annexin a1 anticorps (AA 214-341) (APC)

N° du produit ABIN1858016

L’anticorps Cobaye Polyclonal anti-Annexin a1 a été validé pour WB, IHC, IP et ICC. Il convient pour détecter Annexin a1 dans des échantillons de Lapin.

Aperçu rapide pour Annexin a1 anticorps (AA 214-341) (APC) (ABIN1858016)

Antigène: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Reactivité: Lapin

Hôte: Cobaye

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin a1 est conjugé à/à la APC

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Détail du produit anti-Annexin a1 anticorps (APC)

Épitope: AA 214-341

Fonction: Polyclonal Antibody to Annexin A1 (ANXA1)

Séquence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A

Specificité: The antibody is a cavia polyclonal antibody raised against ANXA1. It has been selected for its ability to recognize ANXA1 in immunohistochemical staining and western blotting.

Réactivité croisée: Humain, Souris, Rat

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogène: RPE787Rb02Recombinant Annexin A1 (ANXA1)

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.

Agent conservateur: ProClin

Précaution d'utilisation: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 12 months

Détails sur Annexin a1

Antigène: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Autre désignation: ANXA1

Sujet: ANX-A1, ANX1, LPC1, Lipocortin I, Chromobindin-9, Calpactin II, Phospholipase A2 inhibitory protein

Pathways: Hormone Transport