TLR5 anticorps

N° du produit ABIN187770

Détail du produit anti-TLR5 anticorps

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR5 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Specificité: Recognizes human Toll-like receptor 5 (TLR5). Peptide sequence is >50% identical to other human TLRs in this region. Species Reactivity: Human. Other species not tested.

Immunogène: Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5.

Information d'application

Indications d'application: Flow Cytometry Immunocytochemistry: 1:500 Immunohistochemistry: Paraffin sections 1:250 Western blot The optimal dilution for a specific application should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Liquid. 100 µg of peptide affinity purified antibody in PBS at 2 mg/ml, containing 1 mg/ml BSA and 0.1% sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Détails sur TLR5

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Autre désignation: TLR5 (TLR5 Produits)

Synonymes: anticorps SLEB1, anticorps TIL3, anticorps TLR-5, anticorps sleb1, anticorps til3, anticorps tlr-5, anticorps tlr5, anticorps toll like receptor 5, anticorps toll-like receptor 5, anticorps toll like receptor 5 L homeolog, anticorps toll-like receptor 5b, anticorps TLR5, anticorps Tlr5, anticorps tlr5.L, anticorps tlr-5, anticorps tlr5b

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades