PTH anticorps (N-Term)

N° du produit ABIN191937

Cet anticorps anti-PTH est un anticorps Rat Monoclonal détectant PTH dans IHC (p), IHC (fro) et EIA. Adapté pour Humain.

Aperçu rapide pour PTH anticorps (N-Term) (ABIN191937)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Rat

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Clone: 3B3

Détail du produit anti-PTH anticorps

Épitope: AA 1-34, N-Term

Specificité: This antibody detects Human oxidized PTH (aa 1-34), native PTH in tissue sections and in circulation. Cross reacts with native PTH (aa 1-84).

Attributs du produit: Synonyms: Parathormone, Parathyrin

Purification: Protein A Chromatography

Immunogène: Synthetic human PTH (aa 1-34) BSA conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Isotype: IgG2b

Information d'application

Indications d'application: ELISA. Immunohistochemistry (Cryo-Sections and Paraffin-Sections): 1/25-50.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4 without preservatives

Agent conservateur: Without preservative

Stock: 4 °C/-20 °C

Stockage commentaire: Store the antibody lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Date de péremption: 12 months

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone / PTH

Classe de substances: Hormone

Sujet: Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.Synonyms: Parathormone, Parathyrin

ID gène: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process