PTH anticorps (N-Term)

N° du produit ABIN191957

Cet anticorps Souris Monoclonal détecte spécifiquement PTH dans IHC (p), RIA, IHC (fro) et EIA. Il présente une réactivité envers Humain.

Aperçu rapide pour PTH anticorps (N-Term) (ABIN191957)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Clone: A1-64

Détail du produit anti-PTH anticorps

Épitope: AA 1-38, N-Term

Specificité: This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1- 86).

Attributs du produit: Synonyms: Parathormone, Parathyrin

Purification: Affinity chromatography

Immunogène: Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Isotype: IgG1

Information d'application

Indications d'application: RIA (25 ng/mL). Immunohistochemistry (cryo-sections and paraffinsections, 2 μg/mL). ELISA (1 μg/mL).
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: 50 mM TRIS, pH 7.4, 0.05 % Sodium Azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Date de péremption: 12 months

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone / PTH

Classe de substances: Hormone

Sujet: Synonyms: Parathormone, Parathyrin

ID gène: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process