ANO1 anticorps

N° du produit ABIN2255013

Cet anticorps anti-ANO1 Monoclonal Souris (Clone DG1-447-DOG-1-1 (mixture of 2 clones)) (ABIN2255013) détecte spécifiquement ANO1 dans IHC, IF, FACS, WB et IP. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ANO1 anticorps (ABIN2255013)

Antigène: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ANO1 est non-conjugé

Application: Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Western Blotting (WB), Immunoprecipitation (IP)

Clone: DG1-447-DOG-1-1 (mixture of 2 clones)

Détail du produit anti-ANO1 anticorps

Séquence: MSDFVDWVIP DIPKDISQQI HKEKVLMVEL FMREEQDKQQ LLETCMEKER QKDEPPCNHH NTKACPDSLG SPAPSHAYHG GVL

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A)

Purification: Purified by Protein A/G affinity chromatography.

Immunogène: Recombinant human DOG-1 protein (clone DG1/447), A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (clone DOG-1.1). Cellular Localization: Cell Surface and Cytoplasmic

Isotype: IgG1 kappa

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, 0.05 % BSA, 0.05 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur ANO1

Antigène: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Autre désignation: DOG-1

Sujet: Cellular Localization: Cell Surface and Cytoplasmic