IL-21 anticorps (N-Term)

N° du produit ABIN7581145

Cet anticorps Chèvre Polyclonal détecte spécifiquement IL-21 dans ELISA et IC. Il présente une réactivité envers Souris.

Aperçu rapide pour IL-21 anticorps (N-Term) (ABIN7581145)

Antigène: IL-21 (IL21) (Interleukin 21 (IL21))

Reactivité: Souris

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-21 est non-conjugé

Application: ELISA, Immunochromatography (IC)

Détail du produit anti-IL-21 anticorps

Épitope: N-Term

Séquence: CRHLIDIVEQ LKIYENDLDP ELLSAPQDVK

Réactivité croisée: Souris

Réactivité croisée (Details): Calculated cross reactivity: Mo

Attributs du produit: Interleukin 21 (IL-21), NT

Purification: Purified by immunoaffinity chromatography.

Immunogène: Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.

Isotype: IgG

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur IL-21

Antigène: IL-21 (IL21) (Interleukin 21 (IL21))

Autre désignation: Interleukin 21

Pathways: Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response