Integrin alpha 3a anticorps (Cytoplasmic Domain)

N° du produit ABIN2295550

Cet anticorps Souris Monoclonal détecte spécifiquement Integrin alpha 3a dans IHC, WB et IC. Il présente une réactivité envers Humain.

Aperçu rapide pour Integrin alpha 3a anticorps (Cytoplasmic Domain) (ABIN2295550)

Antigène: Integrin alpha 3a

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3a est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Clone: 29A3

Détail du produit anti-Integrin alpha 3a anticorps

Épitope: Cytoplasmic Domain

Séquence: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: Integrin alpha 3A

Purification: Purified by Protein G affinity chromatography.

Immunogène: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotype: IgG1

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur Integrin alpha 3a

Antigène: Integrin alpha 3a