Integrin alpha 3a anticorps
Aperçu rapide pour Integrin alpha 3a anticorps (ABIN335346)
Antigène
Reactivité
Hôte
Clonalité
Conjugué
Application
Clone
-
-
Specificité
- Human. A broad species reactivity is expected because of the conserved nature of the epitope.
-
Purification
- Purified
-
Immunogène
- 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
-
Isotype
- IgG2a
-
-
-
-
Indications d'application
- 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. 158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications.
-
Restrictions
- For Research Use only
-
-
-
Stock
- 4 °C
-
-
-
: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." dans: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).
: "Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms." dans: Molecular biology of the cell, Vol. 5, Issue 2, pp. 203-15, (1994) (PubMed).
-
-
- Integrin alpha 3a
-
Sujet
- Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Antigène
-