Integrin alpha 3a anticorps (Cytoplasmic Domain)
-
- Antigène Tous les produits Integrin alpha 3a
- Integrin alpha 3a
- Épitope
- Cytoplasmic Domain
- Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp Integrin alpha 3a est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)
- Séquence
- CRTRALYEAK RQKAEMKSQP SETERLTDDY
- Réactivité croisée
- Humain
- Réactivité croisée (Details)
- Calculated cross reactivity: Hu
- Attributs du produit
- Integrin alpha 3A
- Purification
- Purified by Protein G affinity chromatography.
- Immunogène
- Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
- Clone
- 29A3
- Isotype
- IgG1
-
-
- Indications d'application
- Optimal working conditions should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- -20 °C
- Stockage commentaire
- -20°C
-
- Antigène
- Integrin alpha 3a
- Abstract
- Integrin alpha 3a Produits
-