Integrin alpha 3b anticorps (N-Term)

N° du produit ABIN2295556

Cet anticorps Souris Monoclonal détecte spécifiquement Integrin alpha 3b dans IHC, WB et IC. Il présente une réactivité envers Humain.

Aperçu rapide pour Integrin alpha 3b anticorps (N-Term) (ABIN2295556)

Antigène: Integrin alpha 3b

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3b est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Clone: 54B3

Détail du produit anti-Integrin alpha 3b anticorps

Épitope: N-Term

Séquence: CTRYYQIMPK YHAVRIREEE RYPPPGSTLP TKK

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: Integrin alpha 3B

Purification: Purified by Protein G affinity chromatography.

Immunogène: Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH

Isotype: IgG1

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur Integrin alpha 3b

Antigène: Integrin alpha 3b