EPAS1 anticorps (AA 202-240)

N° du produit ABIN2621893

Cet anticorps anti-EPAS1 est un anticorps Lapin Polyclonal détectant EPAS1 dans WB, IHC et IHC (p). Adapté pour Rat et Orang-Utan.

Aperçu rapide pour EPAS1 anticorps (AA 202-240) (ABIN2621893)

Antigène: EPAS1 (Endothelial PAS Domain Protein 1 (EPAS1))

Reactivité: Rat, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPAS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-EPAS1 anticorps

Épitope: AA 202-240

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Stockage

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Agent conservateur: Sodium azide, Thimerosal (Merthiolate)

Précaution d'utilisation: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur EPAS1

Antigène: EPAS1 (Endothelial PAS Domain Protein 1 (EPAS1))

Autre désignation: HIF2A / EPAS1

Sujet: Name/Gene ID: EPAS1

Synonyms: EPAS1, BHLHe73, ECYT4, HIF-1-alpha-like factor, HIF2-alpha, HIF2A, EPAS-1, HIF-2-alpha, HIF-1alpha-like factor, MOP2, Member of PAS protein 2, PASD2

ID gène: 2034

Pathways: Signaling Events mediated by VEGFR1 and VEGFR2, L'effet Warburg