Phospholamban anticorps (AA 1-35)

N° du produit ABIN2743682

L’anticorps Lapin Polyclonal anti-Phospholamban a été validé pour WB. Il convient pour détecter Phospholamban dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour Phospholamban anticorps (AA 1-35) (ABIN2743682)

Antigène: Phospholamban (PLN)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Phospholamban est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Phospholamban anticorps

Épitope: AA 1-35

Specificité: Heart muscle (at protein level). .

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur Phospholamban

Antigène: Phospholamban (PLN)

Autre désignation: PLN / Phospholamban

Sujet: Name/Gene ID: PLN

Synonyms: PLN, CMD1P, CMH18, PLB, Cardiac phospholamban, Phospholamban

ID gène: 5350

Pathways: Negative Regulation of Transporter Activity