UCHL1 anticorps (C-Term)

N° du produit ABIN3042339

Détail du produit anti-UCHL1 anticorps

Antigène: UCHL1 (Ubiquitin Carboxyl-terminal Esterase L1 (Ubiquitin Thiolesterase) (UCHL1))

Épitope: AA 120-153, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UCHL1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ETEKMSPEDR AKCFEKNEAI QAAHDAVAQE GQCR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin C-terminal hydrolase L1
Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-UCHL1 (ABIN3042339)

Han, Chen, Huang, Zhu: "Nude mice multi-drug resistance model of orthotopic transplantation of liver neoplasm and Tc-99m MIBI SPECT on p-glycoprotein." dans: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3335-8, (2005) (PubMed).

Détails sur UCHL1

Antigène: UCHL1 (Ubiquitin Carboxyl-terminal Esterase L1 (Ubiquitin Thiolesterase) (UCHL1))

Autre désignation: UCHL1 (UCHL1 Produits)

Synonymes: anticorps PARK5, anticorps PGP 9.5, anticorps PGP9.5, anticorps PGP95, anticorps Uch-L1, anticorps UCH-L1, anticorps UCHL1, anticorps cb358, anticorps wu:fc55h08, anticorps park5, anticorps pgp9.5, anticorps uch-l1, anticorps MGC132191, anticorps uchl1, anticorps AW822034, anticorps C88048, anticorps R75593, anticorps UCHL-1, anticorps gad, anticorps ubiquitin C-terminal hydrolase L1, anticorps ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase), anticorps ubiquitin C-terminal hydrolase L1 L homeolog, anticorps ubiquitin carboxyl-terminal esterase L1, anticorps ubiquitin carboxy-terminal hydrolase L1, anticorps UCHL1, anticorps uchl1, anticorps uchl1.L, anticorps LOC100304750, anticorps Uchl1

Sujet: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2 % of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Synonyms: Neuron cytoplasmic protein 9.5 antibody|OTTHUMP00000218137 antibody|OTTHUMP00000218139 antibody|OTTHUMP00000218140 antibody| OTTHUMP00000218141 antibody|Park 5 antibody|PARK5 antibody|PGP 9.5 antibody|PGP9.5 antibody|PGP95 antibody|Protein gene product 9.5 antibody|Ubiquitin C terminal esterase L1 antibody|Ubiquitin C terminal hydrolase antibody|Ubiquitin carboxyl terminal esterase L1 antibody|Ubiquitin carboxyl terminal hydrolase isozyme L1 antibody|Ubiquitin carboxyl-terminal hydrolase isozyme L1 antibody|Ubiquitin thioesterase L1 antibody|Ubiquitin thiolesterase antibody|Ubiquitin thiolesterase L1 antibody|UCH-L1 antibody|UCHL1 antibody| UCHL1_HUMAN antibody

ID gène: 7345

UniProt: P09936

Pathways: Feeding Behaviour