FLT3LG anticorps (N-Term)

N° du produit ABIN3042394

Détail du produit anti-FLT3LG anticorps

Antigène: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Épitope: AA 79-110, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FLT3LG est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.

Séquence: AQRWMERLKT VAGSKMQGLL ERVNTEIHFV TK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.
Gene Name: fms-related tyrosine kinase 3 ligand
Protein Name: Fms-related tyrosine kinase 3 ligand

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FLT3LG

Antigène: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Autre désignation: FLT3LG (FLT3LG Produits)

Synonymes: anticorps Flt3lg, anticorps Ly72L, anticorps FL, anticorps FLT3L, anticorps Vegfr3, anticorps fms related tyrosine kinase 3 ligand, anticorps FMS-like tyrosine kinase 3 ligand, anticorps fms-related tyrosine kinase 4, anticorps fms-related tyrosine kinase 3 ligand, anticorps FLT3LG, anticorps Flt3l, anticorps Flt4, anticorps Flt3lg

Sujet: FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.

Synonyms: Flt 3 ligand antibody|Flt 3L antibody|Flt3 L antibody|FLT3 LG antibody|Flt3 ligand antibody|Flt3L antibody|FLT3L_HUMAN antibody|FLT3LG antibody|Fms related tyrosine kinase 3 ligand antibody|Fms-related tyrosine kinase 3 ligand antibody|SL cytokine antibody

ID gène: 2323

UniProt: P49771

Pathways: Signalisation RTK