CRY1 anticorps (N-Term)

N° du produit ABIN3042761

Détail du produit anti-CRY1 anticorps

Antigène: CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))

Épitope: AA 153-189, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRY1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.

Séquence: FQTLISKMEP LEIPVETITS EVIEKCTTPL SDDHDEK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cryptochrome-1(CRY1) detection. Tested with WB in Human,Rat.
Gene Name: cryptochrome circadian clock 1
Protein Name: Cryptochrome-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CRY1

Antigène: CRY1 (Cryptochrome 1 (Photolyase-Like) (CRY1))

Autre désignation: CRY1 (CRY1 Produits)

Synonymes: anticorps cry1-A, anticorps CRY1, anticorps cry2, anticorps phll1, anticorps xCRY1, anticorps PHLL1, anticorps AU020726, anticorps AU021000, anticorps Phll1, anticorps ATCRY1, anticorps BLU1, anticorps BLUE LIGHT UNINHIBITED 1, anticorps CRYPTOCHROME 1 APOPROTEIN (BLUE LIGHT PHOTORECEPTOR, anticorps ELONGATED HYPOCOTYL 4, anticorps HY4, anticorps OOP2, anticorps OUT OF PHASE 2, anticorps T3H13.14, anticorps T3H13_14, anticorps cryptochrome 1, anticorps cryptochrome circadian clock 1 L homeolog, anticorps cryptochrome circadian regulator 1, anticorps cryptochrome circadian clock 1, anticorps Cryptochrome-1, anticorps cryptochrome 1, anticorps cryptochrome 1 (photolyase-like), anticorps cry1.L, anticorps CRY1, anticorps cry1, anticorps siu50817b, anticorps Cry1

Sujet: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Synonyms: Cry1 antibody|CRY1_HUMAN antibody|Cryptochrome 1 (photolyase like) antibody|Cryptochrome 1 antibody|Cryptochrome-1 antibody|PHLL1 antibody|Photolyase 1 antibody|Photolyase-like antibody

ID gène: 1407

UniProt: Q16526

Pathways: Response to Water Deprivation, Proton Transport