Stathmin 1 anticorps (N-Term)

N° du produit ABIN3043301

Détail du produit anti-Stathmin 1 anticorps

Antigène: Stathmin 1 (STMN1)

Épitope: AA 2-34, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Stathmin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ASSDIQVKEL EKRASGQAFE LILSPRSKES VPE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: stathmin 1
Protein Name: Stathmin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Stathmin 1

Antigène: Stathmin 1 (STMN1)

Autre désignation: STMN1 (STMN1 Produits)

Synonymes: anticorps C1orf215, anticorps LAP18, anticorps Lag, anticorps OP18, anticorps PP17, anticorps PP19, anticorps PR22, anticorps SMN, anticorps 19k, anticorps Lap18, anticorps Op18, anticorps P18, anticorps P19, anticorps Pig, anticorps Pp17, anticorps Pp18, anticorps Pp19, anticorps Pr22, anticorps Smn, anticorps prosolin, anticorps op18, anticorps stathmin, anticorps stmn1, anticorps stmn1a, anticorps lag, anticorps lap18, anticorps pp17, anticorps pp19, anticorps pr22, anticorps smn, anticorps fj43c10, anticorps wu:fj38b07, anticorps wu:fj43c10, anticorps zgc:110159, anticorps cb959, anticorps wu:fb14e04, anticorps zgc:136942, anticorps stmn1-a, anticorps stmn1b, anticorps xo35, anticorps stathmin 1, anticorps stathmin 1 S homeolog, anticorps stathmin 1b, anticorps stathmin 1a, anticorps stathmin-like, anticorps stathmin, anticorps stathmin 1 L homeolog, anticorps STMN1, anticorps Stmn1, anticorps stmn1.S, anticorps stmn1, anticorps stmn1b, anticorps stmn1a, anticorps LOC100229194, anticorps stmn1.L

Sujet: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: C1orf215 antibody|Lag antibody|LAP 18 antibody|LAP18 antibody|Leukemia associated phosphoprotein p18 antibody|Leukemia-associated phosphoprotein p18 antibody|Metablastin antibody|Oncoprotein 18 antibody|OP 18 antibody|OP18 antibody|p18 antibody|p19 antibody| Phosphoprotein 19 antibody|Phosphoprotein p19 antibody|PP17 antibody|PP19 antibody|PR22 antibody|Pr22 protein antibody|Prosolin antibody|Protein Pr22 antibody|SMN antibody| Stathmin antibody|Stathmin1 antibody|STMN 1 antibody|STMN1 antibody|STMN1_HUMAN antibody

ID gène: 3925

UniProt: P16949

Pathways: Signalisation MAPK, Dynamique des Microtubules